- HDHD3 Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-86707
- PBS (pH 7.2) and 40% Glycerol
- Human
- 2810435D12Rik, C9orf158
- 0.1 ml (also 25ul)
- Rabbit
- This antibody was developed against Recombinant Protein corresponding to amino acids: LQTFHLAGVQ DAQAVAPIAE QLYKDFSHPC TWQVLDGAED TLRECRTRGL RLAVISNFDR RLEGILGGLG LREHFDFVLT SEAAGW
- Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin
- HDHD3
- Unconjugated
- haloacid dehalogenase like hydrolase domain containing 3
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- Lipid and Metabolism
- Primary Antibodies
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
LQTFHLAGVQDAQAVAPIAEQLYKDFSHPCTWQVLDGAEDTLRECRTRGLRLAVISNFDRRLEGILGGLGLREHFDFVLTSEAAGW
Specifications/Features
Available conjugates: Unconjugated